PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_011070914.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Pedaliaceae; Sesamum
Family SBP
Protein Properties Length: 353aa    MW: 39105.9 Da    PI: 8.2295
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_011070914.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP134.82.7e-4247123177
                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                     +Cqv gC++dls+ k+yh+rhkvC+vhsk++vv+v+g++qrfCqqCsrfh l efDe+krsCr+rLa+hnerrrk+q
  XP_011070914.1  47 TCQVLGCNKDLSSSKDYHKRHKVCDVHSKTAVVIVNGIQQRFCQQCSRFHVLAEFDEGKRSCRKRLAGHNERRRKPQ 123
                     6**************************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.4E-3442109IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.62445122IPR004333Transcription factor, SBP-box
SuperFamilySSF1036128.44E-4046126IPR004333Transcription factor, SBP-box
PfamPF031105.4E-3248121IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010468Biological Processregulation of gene expression
GO:0042742Biological Processdefense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
VIDEKLAAPK EKNDNQFSVD NSVLSSPEPF VPAKRARITN LQSQIPTCQV LGCNKDLSSS  60
KDYHKRHKVC DVHSKTAVVI VNGIQQRFCQ QCSRFHVLAE FDEGKRSCRK RLAGHNERRR  120
KPQFDNHLGA AYFTTDASNF SRFLSGGFFG LQYNEPAMRS GHLKLEEEPS QISQLPAPMK  180
FSQSLPKSLL HLHGMGKQYP SKNCLNHSLS VQELSVGSNS SCALSLLSAQ SQNLVNNSAG  240
TSMPHPQIAQ ENLHADLCTI QNSAKCFGSD NLSPSIVNSS GTDQERSSVG LEVPQTELSQ  300
EPNAPRLKSY LSSEGANTVD LLELSIHLQR VEQQKHYTQF KLENGIFCHS TIT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A9e-3143121684squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011070914.10.0PREDICTED: squamosa promoter-binding-like protein 6, partial
TrEMBLK4BXS71e-96K4BXS7_SOLLC; Uncharacterized protein
STRINGSolyc05g012040.2.13e-96(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA68311933
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69170.11e-49SBP family protein